HPA003221

RPS6KA3 antibody from Sigma-Aldrich
CLS, HU-3, MRX19, RSK, RSK2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003221
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003221, RRID:AB_1853553
Product name
Anti-RPS6KA3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003221
Antibody type
Polyclonal
Antigen
Ribosomal protein S6 kinase alpha-3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MPLAQLADPWQKMAVESPSDSAENGQQIMDEPMGE
EEINPQTEEVSIKEIAITHHVKEGHEKADPSQFEL
LKVLGQGSFGKVFLVKKISGSDARQLYAMKVLKKA
TLKVRDRVRTKMERDILVEVNHPFIVKLHYAFQTE
GKLY
Storage
-20C
Provider Type Product Number
- No reagents -