H00002917-M01A

GRM7 antibody from Abnova Corporation
GLUR7, GPRC1G, mGlu7, MGLUR7, PPP1R87
No application information provided.

Antibody data

Product number
H00002917-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002917-M01A, RRID:AB_1575322
Product name
GRM7 monoclonal antibody (M01A), clone 1H5
Provider product page
Abnova Corporation - H00002917-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant GRM7.
Antigen sequence
ADYRGVCPEMEQAGGKKLLKYIRNVNFNGSAGTPV
MFNKNGDAPGRYDIFQYQTTNTSNPGYRLIGQWTD
ELQLNIEDMQWGKGVREIPA
Isotype
IgG
Antibody clone number
1H5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -