ABIN617145

GRM7 antibody from antibodies-online
GLUR7, GPRC1G, mGlu7, MGLUR7, PPP1R87

Antibody data

Product number
ABIN617145
Provider
antibodies-online
Product name
anti-Glutamate Receptor, Metabotropic 7 (GRM7) (C-Term) antibody
Provider product page
antibodies-online - ABIN617145
Antibody type
Polyclonal
Antigen
The immunogen for anti-GRM7 antibody: synthetic peptide directed towards the C terminal of human GRM7
Description
Affinity Purified
Reactivity
Human
Host
Rabbit
Antigen sequence
HPELNVQKRKRSFKAVVTAATMSSRLSHKPSDRPN
GEAKT ELCENVDPNS
Epitope
C-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -