Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001906-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001906-M01, RRID:AB_463795
- Product name
- EDN1 monoclonal antibody (M01), clone 3D6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant EDN1.
- Antigen sequence
SQKDKKCWNFCQAGKELRAEDIMEKDWNNHKKGKD
CSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETM
RNSVKSSFHDPKLKGNPSRERYVTHNRAHW- Isotype
- IgG
- Antibody clone number
- 3D6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Calpain-6 is an endothelin-1 signaling dependent protective factor in chemoresistant osteosarcoma.
Endothelin type A and B receptors in the control of afferent and efferent arterioles in mice.
Epithelial-to-mesenchymal transition and resistance to ingenol 3-angelate, a novel protein kinase C modulator, in colon cancer cells.
Marion A, Dieudonné FX, Patiño-Garcia A, Lecanda F, Marie PJ, Modrowski D
International journal of cancer 2012 Jun 1;130(11):2514-25
International journal of cancer 2012 Jun 1;130(11):2514-25
Endothelin type A and B receptors in the control of afferent and efferent arterioles in mice.
Schildroth J, Rettig-Zimmermann J, Kalk P, Steege A, Fähling M, Sendeski M, Paliege A, Lai EY, Bachmann S, Persson PB, Hocher B, Patzak A
Nephrology, dialysis, transplantation : official publication of the European Dialysis and Transplant Association - European Renal Association 2011 Mar;26(3):779-89
Nephrology, dialysis, transplantation : official publication of the European Dialysis and Transplant Association - European Renal Association 2011 Mar;26(3):779-89
Epithelial-to-mesenchymal transition and resistance to ingenol 3-angelate, a novel protein kinase C modulator, in colon cancer cells.
Ghoul A, Serova M, Astorgues-Xerri L, Bieche I, Bousquet G, Varna M, Vidaud M, Phillips E, Weill S, Benhadji KA, Lokiec F, Cvitkovic E, Faivre S, Raymond E
Cancer research 2009 May 15;69(10):4260-9
Cancer research 2009 May 15;69(10):4260-9
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of EDN1 expression in transfected 293T cell line by EDN1 monoclonal antibody (M01), clone 3D6.Lane 1: EDN1 transfected lysate(24 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged EDN1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of EDN1 transfected lysate using anti-EDN1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with EDN1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol