HPA004774

PCSK6 antibody from Atlas Antibodies
PACE4, SPC4
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004774
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004774, RRID:AB_1079583
Product name
Anti-PCSK6
Provider product page
Atlas Antibodies - HPA004774
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RPVYTNHWAVQVLGGPAEADRVAAAHGYLNLGQIG
NLEDYYHFYHSKTFKRSTLSSRGPHTFLRMDPQVK
WLQQQEVKRRVKR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -