HPA004774

PCSK6 antibody from Sigma-Aldrich
PACE4, SPC4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004774
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004774, RRID:AB_1079583
Product name
Anti-PCSK6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004774
Antibody type
Polyclonal
Antigen
Proprotein convertase subtilisin/kexin type 6 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RPVYTNHWAVQVLGGPAEADRVAAAHGYLNLGQIG
NLEDYYHFYHSKTFKRSTLSSRGPHTFLRMDPQVK
WLQQQEVKRRVKR
Storage
-20C
Provider Type Product Number
- No reagents -