HPA005131

REN antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005131
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005131, RRID:AB_1079174
Product name
Anti-REN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005131
Antibody type
Polyclonal
Antigen
Renin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLAL
VDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKC
NEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKK
LCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFD
Storage
-20C
Provider Type Product Number
- No reagents -