HPA019035

ABCB11 antibody from Sigma-Aldrich
ABC16, BSEP, PFIC-2, PFIC2, PGY4, SPGP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019035
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019035, RRID:AB_1844429
Product name
Anti-ABCB11 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019035
Antibody type
Polyclonal
Antigen
Bile salt export pump recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RLSTVRAADTIIGFEHGTAVERGTHEELLERKGVY
FTLVTLQSQGNQALNEEDIKDATEDDMLARTFSRG
SYQDSLRASIRQRSKSQLSYLVHEPPLAVVDHKST
YEEDRKDKDIPVQEEVEPAPVRRILK
Storage
-20C
Provider Type Product Number
- No reagents -