HPA005992

CAPN1 antibody from Sigma-Aldrich
CANP, CANPL1, muCANP, muCL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005992
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005992, RRID:AB_1845924
Product name
Anti-CAPN1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005992
Antibody type
Polyclonal
Antigen
Calpain-1 catalytic subunit recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PDALKSRTIRKWNTTLYEGTWRRGSTAGGCRNYPA
TFWVNPQFKIRLDETDDPDDYGDRESGCSFVLALM
QKHRRRERRFGRDMETIGFAVYEVPPELVGQPAVH
LKRDFFLANASRARSEQFINLREVSTRFRLPPGEY
VVVPSTFEPNKE
Storage
-20C
Provider Type Product Number
- No reagents -