PAB29332

BIRC3 antibody from Abnova Corporation
API2, c-IAP2, cIAP2, hiap-1, MALT2, MIHC, RNF49

Antibody data

Product number
PAB29332
Provider
Abnova Corporation
Product name
BIRC3 polyclonal antibody
Provider product page
Abnova Corporation - PAB29332
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant human BIRC3.
Antigen sequence
QHAKWFPRCEYLIRIKGQEFIRQVQASYPHLLEQL
LSTSDSPGDENAESSIIHFEPGEDHSEDAIMMNTP
VINAAVEMGFSRSLVKQTVQRKILATGENYRLVND
LVLDLLNAEDEIREEERERATEE
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -