H00000330-D01

BIRC3 antibody from Abnova Corporation
API2, c-IAP2, cIAP2, hiap-1, MALT2, MIHC, RNF49

Antibody data

Product number
H00000330-D01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000330-D01, RRID:AB_10715839
Product name
BIRC3 MaxPab rabbit polyclonal antibody (D01)
Provider product page
Abnova Corporation - H00000330-D01
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human BIRC3 protein.
Antigen sequence
MNIVENSIFLSNLMKSANTFELKYDLSCELYRMST
YSTFPAGVPVSERSLARAGFYYTGVNDKVKCFCCG
LMLDNWKRGDSPTEKHKKLYPSCRFVQSLNSVNNL
EATSQPTFPSSVTNSTHSLLPGTENSGYFRGSYSN
SPSNPVNSRANQDFSALMRSSYHCAMNNENARLLT
FQTWPLTFLSPTDLAKAGFYYIGPGDRVACFACGG
KLSNWEPKDNAMSEHLRHFPKCPFIENQLQDTSRY
TVSNLSMQTHAARFKTFFNWPSSVLVNPEQLASAG
FYYVGNSDDVKCFCCDGGLRCWESGDDPWVQHAKW
FPRCEYLIRIKGQEFIRQVQASYPHLLEQLLSTSD
SPGDENAESSIIHFEPGEDHSEDAIMMNTPVINAA
VEMGFSRSLVKQTVQRKILATGENYRLVNDLVLDL
LNAEDEIREEERERATEEKESNDLLLIRKNRMALF
QHLTCVIPILDSLLTAGIINEQEHDVIKQKTQTSL
QARELIDTILVKGNIAATVFRNSLQEAEAVLYEHL
FVQQDIKYIPTEDVSDLPVEEQLRRLQEERTCKVC
MDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTI
KGTVRTFLS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -