SAB1401013

BIRC3 antibody from Sigma-Aldrich
API2, c-IAP2, cIAP2, hiap-1, MALT2, MIHC, RNF49
No application information provided.

Antibody data

Product number
SAB1401013
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1401013, RRID:AB_10610587
Product name
Anti-BIRC3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB1401013
Antibody type
Polyclonal
Antigen
BIRC3 (NP_001156.1, 1 a.a. ~ 604 a.a) full-length human protein.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MNIVENSIFLSNLMKSANTFELKYDLSCELYRMST
YSTFPAGVPVSERSLARAGFYYTGVNDKVKCFCCG
LMLDNWKRGDSPTEKHKKLYPSCRFVQSLNSVNNL
EATSQPTFPSSVTNSTHSLLPGTENSGYFRGSYSN
SPSNPVNSRANQDFSALMRSSYHCAMNNENARLLT
FQTWPLTFLSPTDLAKAGFYYIGPGDRVACFACGG
KLSNWEPKDNAMSEHLRHFPKCPFIENQLQDTSRY
TVSNLSMQTH
Storage
-20C
Provider Type Product Number
- No reagents -