Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001808-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001808-M01, RRID:AB_1674809
- Product name
- DPYSL2 monoclonal antibody (M01), clone 1F11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant DPYSL2.
- Antigen sequence
PRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVC
EVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGF
SLSGAQIDDNIPRRTTQRIVAPPGGRANITSL- Isotype
- IgG
- Antibody clone number
- 1F11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Quantitative proteome analysis of pluripotent cells by iTRAQ mass tagging reveals post-transcriptional regulation of proteins required for ES cell self-renewal.
O'Brien RN, Shen Z, Tachikawa K, Lee PA, Briggs SP
Molecular & cellular proteomics : MCP 2010 Oct;9(10):2238-51
Molecular & cellular proteomics : MCP 2010 Oct;9(10):2238-51
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged DPYSL2 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to DPYSL2 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol