HPA002381

DPYSL2 antibody from Atlas Antibodies
CRMP2, DHPRP2, DRP-2, DRP2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002381
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002381, RRID:AB_1847244
Product name
Anti-DPYSL2
Provider product page
Atlas Antibodies - HPA002381
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQ
WREWADSKSCCDYSLHVDISEWHKGIQEEMEALVK
DHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIG
AIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -