HPA002381

DPYSL2 antibody from Sigma-Aldrich
CRMP2, DHPRP2, DRP-2, DRP2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002381
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002381, RRID:AB_1847244
Product name
Anti-DPYSL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002381
Antibody type
Polyclonal
Antigen
Dihydropyrimidinase-related protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQ
WREWADSKSCCDYSLHVDISEWHKGIQEEMEALVK
DHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIG
AIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSR
Storage
-20C
Provider Type Product Number
- No reagents -