Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010253-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010253-M01, RRID:AB_437097
- Product name
- SPRY2 monoclonal antibody (M01), clone 1E10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant SPRY2.
- Antigen sequence
MEARAQSGNGSQPLLQTPRDGGRQRGEPDPRDALT
QQVHVLSLDQIRAIRNTNEYTEGPTVVPRPGLKPA
PRPSTQHKHERLHGLPEHRQPPRLQHSQVHSSARA
PLSRSISTVSSGSRSSTRTSTSSSSSEQRLLGSSF
SSGPVADGIIRVQPKSELKPGELKPLSKEDLGLHA
YRCEDCGKCKCKECTYPRPLPSDWICDKQCLCSAQ
NVIDYGTCVCCVKGLFYHCSNDDEDNCADNPCSCS
QSHCCTRWSAMGVMSLFLPCLWCYLPAKGCLKLCQ
GCYDRVNRPGCRCKNSNTVCCKVPTVPPRNFEKPT- Isotype
- IgG
- Antibody clone number
- 1E10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references SPROUTY2 is a β-catenin and FOXO3a target gene indicative of poor prognosis in colon cancer.
Initial report on differential expression of sprouty proteins 1 and 2 in human epithelial ovarian cancer cell lines.
SPROUTY-2 and E-cadherin regulate reciprocally and dictate colon cancer cell tumourigenicity.
Ordóñez-Morán P, Irmisch A, Barbáchano A, Chicote I, Tenbaum S, Landolfi S, Tabernero J, Huelsken J, Muñoz A, Pálmer HG
Oncogene 2014 Apr 10;33(15):1975-85
Oncogene 2014 Apr 10;33(15):1975-85
Initial report on differential expression of sprouty proteins 1 and 2 in human epithelial ovarian cancer cell lines.
Moghaddam SM, Amini A, Wei AQ, Pourgholami MH, Morris DL
Journal of oncology 2012;2012:373826
Journal of oncology 2012;2012:373826
SPROUTY-2 and E-cadherin regulate reciprocally and dictate colon cancer cell tumourigenicity.
Barbáchano A, Ordóñez-Morán P, García JM, Sánchez A, Pereira F, Larriba MJ, Martínez N, Hernández J, Landolfi S, Bonilla F, Pálmer HG, Rojas JM, Muñoz A
Oncogene 2010 Aug 26;29(34):4800-13
Oncogene 2010 Aug 26;29(34):4800-13
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SPRY2 monoclonal antibody (M01), clone 1E10 Western Blot analysis of SPRY2 expression in C32 ( Cat # L002V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of SPRY2 expression in transfected 293T cell line by SPRY2 monoclonal antibody (M01), clone 1E10.Lane 1: SPRY2 transfected lysate(34.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SPRY2 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to SPRY2 on HeLa cell. [antibody concentration 25 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to SPRY2 on formalin-fixed paraffin-embedded human lymphoma. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol