HPA018277

ADARB1 antibody from Sigma-Aldrich
ADAR2, ADAR2a, ADAR2a-L1, ADAR2a-L2, ADAR2a-L3, ADAR2b, ADAR2c, ADAR2d, ADAR2g, DRABA2, DRADA2, hRED1, RED1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018277
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018277, RRID:AB_1844591
Product name
Anti-ADARB1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018277
Antibody type
Polyclonal
Antigen
Double-stranded RNA-specific editase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SVNTDFTSDQADFPDTLFNGFETPDKAEPPFYVGS
NGDDSFSSSGDLSLSASPVPASLAQPPLPVLPPFP
PPSGKNPVMILNELRPGLKYDFLSESGESHAKSFV
MSVVV
Storage
-20C
Provider Type Product Number
- No reagents -