HPA003524

CTSH antibody from Atlas Antibodies
ACC-4, ACC-5, ACC4, ACC5, CPSB
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003524
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003524, RRID:AB_1846075
Product name
Anti-CTSH
Provider product page
Atlas Antibodies - HPA003524
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPG
KAIGFVKDVANITIYDEEAMVEAVALYNPVSFAFE
VTQDFMMYRTGIYSSTSCHKTPDKVNHAVLAVGYG
EKNGIPYWIVKNSWGPQWGMNGYFL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -