HPA003524

CTSH antibody from Sigma-Aldrich
ACC-4, ACC-5, ACC4, ACC5, CPSB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003524
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003524, RRID:AB_1846075
Product name
Anti-CTSH antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003524
Antibody type
Polyclonal
Antigen
Cathepsin H precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPG
KAIGFVKDVANITIYDEEAMVEAVALYNPVSFAFE
VTQDFMMYRTGIYSSTSCHKTPDKVNHAVLAVGYG
EKNGIPYWIVKNSWGPQWGMNGYFL
Storage
-20C
Provider Type Product Number
- No reagents -