HPA002116

TNFAIP3 antibody from Atlas Antibodies
A20, OTUD7C
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002116
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002116, RRID:AB_1858162
Product name
Anti-TNFAIP3
Provider product page
Atlas Antibodies - HPA002116
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QECYRYPIVLGYDSHHFVPLVTLKDSGPEIRAVPL
VNRDRGRFEDLKVHFLTDPENEMKEKLLKEYLMVI
EIPVQGWDHGTTHLINAAKLDEANLPKEINLVDDY
FELVQHEYKKW
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -