HPA002116

TNFAIP3 antibody from Sigma-Aldrich
A20, OTUD7C
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002116
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002116, RRID:AB_1858162
Product name
Anti-TNFAIP3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002116
Antibody type
Polyclonal
Antigen
Tumor necrosis factor, alpha-induced protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QECYRYPIVLGYDSHHFVPLVTLKDSGPEIRAVPL
VNRDRGRFEDLKVHFLTDPENEMKEKLLKEYLMVI
EIPVQGWDHGTTHLINAAKLDEANLPKEINLVDDY
FELVQHEYKKW
Storage
-20C
Provider Type Product Number
- No reagents -