HPA005832

CCDC88C antibody from Sigma-Aldrich
DAPLE, HkRP2, KIAA1509, SCA40
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005832
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005832, RRID:AB_1079202
Product name
Anti-CCDC88C antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005832
Antibody type
Polyclonal
Antigen
DAPLE_HUMAN Isoform 2 of Q9P219-Homo sapiens recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSLESSRNTSSNSSPLNLKGSSEQLHGRSESFSSE
DLIPSRDLATLPREASTPGRNALGRHEYPLPRNGP
LPQEGAQKRGTAPPYVGVRPCSASPSSEMVTLEEF
LEESNRSSPTHDTPSCRDDLLSD
Storage
-20C
Provider Type Product Number
- No reagents -