Antibody data

Product number
ABIN309587
Provider
antibodies-online
Product name
anti-Telomeric Repeat Binding Factor 2 (TERF2) (C-Term) antibody
Provider product page
antibodies-online - ABIN309587
Antibody type
Polyclonal
Antigen
The immunogen for anti-TERF2 antibody: synthetic peptide directed towards the C terminal of human TERF2
Description
Protein A purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Xenopus
Host
Rabbit
Antigen sequence
TVEESEWVKAGVQKYGEGNWAAISKNYPFVNRTAV
MIKDR WRTMKRLGMN
Epitope
C-Term
Vial size
100 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -