Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309587 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Telomeric Repeat Binding Factor 2 (TERF2) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TERF2 antibody: synthetic peptide directed towards the C terminal of human TERF2
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus
- Host
- Rabbit
- Antigen sequence
TVEESEWVKAGVQKYGEGNWAAISKNYPFVNRTAV
MIKDR WRTMKRLGMN- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Tethering telomeric double- and single-stranded DNA-binding proteins inhibits telomere elongation.
Etheridge KT, Compton SA, Barrientos KS, Ozgur S, Griffith JD, Counter CM
The Journal of biological chemistry 2008 Mar 14;283(11):6935-41
The Journal of biological chemistry 2008 Mar 14;283(11):6935-41
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting