Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb91136 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb91136, RRID:AB_2665815
- Product name
- Anti-LAMC1
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
ECREGFVGNRCDQCEENYFYNRSWPGCQECPACYR
LVKDKVADHRVKLQELESLIANLGTGDEMVTDQAF
EDRLKEAEREVMDLLREAQDVKDVDQNLMDRLQRV
NNTLSSQISRLQNIRNTIEETGNLAEQARAHVENT
ERLIEIASR- Isotype
- IgG
- Antibody clone number
- CL3195
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis of purified human recombinant Laminin-111, Laminin-121, Laminin-211, Laminin-221, Laminin-411, Laminin-421, Laminin-511, Laminin-521 and Laminin-332.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum shows strong immunoreactivity in basement membrane of glandular epithelium.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows strong positivity in basement membrane of glandular epithelium.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows strong immunoreactivity in basement membrane of renal tubules and membranous positivity in glomeruli.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong positivity in basement membrane in seminiferous tubules.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum shows strong immunoreactivity in endothelium.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node shows absence of immunoreactivity in lymphoid cells (negative control).