AMAb91138

antibody from Atlas Antibodies

Targeting: LAMC1 LAMB2

Antibody data

Submit

Validation data

Product number: AMAb91138 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#AMAb91138, RRID:AB_2665817
Product name: Anti-LAMC1
Antibody type: Monoclonal
Reactivity: Human, Rat
Host: Mouse
Conjugate: Unconjugated
Antigen sequence: STKAEAERTFAEVTDLDNEVNNMLKQLQEAEKELK RKQDDADQDMMMAGMASQAAQEAEINARKAKNSVT SLLSIINDLLEQLGQLDTVDLNKLNEIEGTLNKAK DEMKVS
Epitope: Binds to an epitope located within the peptide sequence AEVTDLDNEVNNMLK as determined by overlapping synthetic peptides.
Isotype: IgG
Antibody clone number: CL3199
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

LAMC1 protein structure - AMAb91138 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human placenta and tonsil tissues using AMAb91138 antibody. Corresponding LAMC1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong immunoreactivity in basement membrane of renal tubules and membranous positivity in glomeruli.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows strong positivity in basement membrane of glandular epithelium.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human endometrium shows strong immunoreactivity in basement membrane of glandular epithelium.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cervix shows moderate positivity in basement membrane of squamous epithelium.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows strong immunoreactivity in endothelium.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows absence of immunoreactivity in lymphoid cells (negative control).

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining or rat rectum shows immunoreactivity in basement membrane of glandular epithelium.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining or rat kidney shows immunoreactivity in basement membranes of renal tubules and glomeruli.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of rat pancreas shows immunoreactivity in basement membrane surrounding exocrine glands.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows strong positivity in basement membrane of trophoblastic cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human rectum shows moderate positivity in basement membrane of glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows moderate positivity in basement membrane of cells in tubules and glomeruli.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows no positivity in lymphoid cells as expected.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of rat rectum shows moderate positivity in basement membrane of glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of rat kidney shows moderate positivity in basement membrane of cells in tubules and glomeruli.