Explore
Validate
Learn
ELISAAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- ELISA [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003915-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003915-M03, RRID:AB_464033
- Product name
- LAMC1 monoclonal antibody (M03), clone M1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant LAMC1.
- Antigen sequence
MNKRRTSHRIWKNKLPEYMRRPKGPVTKLWRSMPA
WLS- Isotype
- IgG
- Antibody clone number
- M1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged LAMC1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between LAMA5 and LAMC1. HeLa cells were stained with anti-LAMA5 rabbit purified polyclonal 1:1200 and anti-LAMC1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)
