Antibody data
- Product number
- HPA001909
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001909, RRID:AB_1079230
- Product name
- Anti-LAMC1
- Provider product page
- Atlas Antibodies - HPA001909
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
STKAEAERTFAEVTDLDNEVNNMLKQLQEAEKELK
RKQDDADQDMMMAGMASQAAQEAEINARKAKNSVT
SLLSIINDLLEQLGQLDTVDLNKLNEIEGTLNKAK
DEMKVS
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human cell line A-431Lane 5: Human liver tissueLane 6: Human tonsil tissue
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human placenta shows high expression.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human tonsil shows low expression as expected.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human kidney using Anti-LAMC1 antibody HPA001909.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human cerebral cortex using Anti-LAMC1 antibody HPA001909.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image

- Experimental details
- Immunohistochemistry analysis in human placenta and tonsil tissues using Anti-LAMC1 antibody. Corresponding LAMC1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
- Orthogonal method
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Show more
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image

- Experimental details
- Immunohistochemical staining of human cerebral cortex, kidney, placenta and tonsil using Anti-LAMC1 antibody HPA001909 (A) shows similar protein distribution across tissues to independent antibody HPA001908 (B).
- Antibody #2 product nr
- HPA001908
- Antibody provider
- Atlas Antibodies
- Show more