HPA001909

LAMC1 antibody from Sigma-Aldrich
LAMB2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001909
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001909, RRID:AB_1079230
Product name
Anti-LAMC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001909
Antibody type
Polyclonal
Antigen
Laminin subunit gamma-1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
STKAEAERTFAEVTDLDNEVNNMLKQLQEAEKELK
RKQDDADQDMMMAGMASQAAQEAEINARKAKNSVT
SLLSIINDLLEQLGQLDTVDLNKLNEIEGTLNKAK
DEMKVS
Storage
-20C
Provider Type Product Number
- No reagents -