H00010643-M01A

IGF2BP3 antibody from Abnova Corporation
CT98, IMP-3, IMP3

Antibody data

Product number
H00010643-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010643-M01A, RRID:AB_1204543
Product name
IMP-3 monoclonal antibody (M01A), clone 3B12
Provider product page
Abnova Corporation - H00010643-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant IMP-3.
Antigen sequence
MNKLYIGNLSENAAPSDLESIFKDAKIPVSGPFLV
KTGHAFVDCPDESWALKAIEALSGKIELHGKPIEV
EHSVPKRQRIRKLQIRNIPPHLQWEVLDSLLVQYG
VVESCEQVNTDSETAVVNVTYSSKDQARQALDKLN
GFQLENFTLKVAYIPDEMAAQQNPLQQPRGRRGLG
QRGSSRQGSPGSVSKQKPCDLPLRLLVPTQFVGAI
IGKEGATIRNITKQTQSKIDVHRKENAGAAEKSIT
ILSTPEGTSAACKSILEIMHKEAQDIKFTEEIPLK
ILAHNNFVGRLIGKEGRNLKKIEQDTDTKITISPL
QELTLYNPERTITVKGNVETCAKAEEEIMKKIRES
YENDIASMNLQAHLIPGLNLNALGLFPPTSGMPPP
TSGPPSAMTPPYPQFEQSETETVHLFIPALSVGAI
IGKQGQHIKQLSRFAGASIKIAPAEAPDAKVRMVI
ITGPPEAQFKAQGRIYGKIKEENFVSPKEEVKLEA
HIRVPSFAAGRVIGKGGKTVNELQNLSSAEVVVPR
DQTPDENDQVVVKITGHFYACQVAQRKIQEILTQV
KQHQQQKALQSGPPQSRRK
Isotype
IgM
Antibody clone number
3B12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -