HPA002037

IGF2BP3 antibody from Atlas Antibodies
CT98, IMP-3, IMP3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002037
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002037, RRID:AB_1851483
Product name
Anti-IGF2BP3
Provider product page
Atlas Antibodies - HPA002037
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VVESCEQVNTDSETAVVNVTYSSKDQARQALDKLN
GFQLENFTLKVAYIPDEMAAQQNPLQQPRGRRGLG
QRGSSRQGSPGSVSKQKPCDLPLRLLVPTQFVGAI
IGKEGATIRNITKQTQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -