HPA002037

IGF2BP3 antibody from Sigma-Aldrich
CT98, IMP-3, IMP3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002037
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002037, RRID:AB_1851483
Product name
Anti-IGF2BP3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002037
Antibody type
Polyclonal
Antigen
Insulin-like growth factor 2 mRNA-binding protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VVESCEQVNTDSETAVVNVTYSSKDQARQALDKLN
GFQLENFTLKVAYIPDEMAAQQNPLQQPRGRRGLG
QRGSSRQGSPGSVSKQKPCDLPLRLLVPTQFVGAI
IGKEGATIRNITKQTQ
Storage
-20C
Provider Type Product Number
- No reagents -