PAB28583

IRF8 antibody from Abnova Corporation
ICSBP, ICSBP1, IRF-8

Antibody data

Product number
PAB28583
Provider
Abnova Corporation
Product name
IRF8 polyclonal antibody
Provider product page
Abnova Corporation - PAB28583
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant IRF8.
Antigen sequence
PDFEEVTDRSQLDISEPYKVYRIVPEEEQKCKLGV
ATAGCVNEVTEMECGRSEIDELIKEPSVDDYMGMI
KRSPSPPEACRSQLLPDWWAQQPSTGVPLVTGYTT
YDAHHSAFSQMVISFYY
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -