ABIN504658

IRF8 antibody from antibodies-online
ICSBP, ICSBP1, IRF-8
Western blot
Recommended by provider
Immunohistochemistry
Data presented on provider website

Antibody data

Product number
ABIN504658
Provider
antibodies-online
Product name
anti-Interferon Regulatory Factor 8 (IRF8) antibody
Provider product page
antibodies-online - ABIN504658
Antibody type
Polyclonal
Antigen
The immunogen for anti-IRF8 antibody: synthetic peptide directed towards the middle region of human IRF8
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus
Host
Rabbit
Antigen sequence
QLAEEAGKSCGAGSVMQAPEEPPPDQVFRMFPDIC
ASHQR SFFRENQQIT
Vial size
50 μg
Storage
Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Provider Type Product Number
- No reagents -