Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184318 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Interferon Regulatory Factor 8 (IRF8) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-IRF8 antibody: synthetic peptide directed towards the N terminal of human IRF8
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
MFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKE
GDKAE PATWKTRLRC- Vial size
- 50 μg
- Storage
- Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Submitted references Human interferon consensus sequence binding protein is a negative regulator of enhancer elements common to interferon-inducible genes.
Weisz A, Marx P, Sharf R, Appella E, Driggers PH, Ozato K, Levi BZ
The Journal of biological chemistry 1992 Dec 15;267(35):25589-96
The Journal of biological chemistry 1992 Dec 15;267(35):25589-96
No comments: Submit comment
No validations: Submit validation data