Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184319 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Interferon Regulatory Factor 8 (IRF8) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-IRF8 antibody: synthetic peptide directed towards the N terminal of human IRF8
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Canine, Zebrafish
- Host
- Rabbit
- Antigen sequence
MFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKE
GDKAE PATWKTRLRC- Vial size
- 0.1 mg
- Storage
- Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Submitted references Repression of IFN regulatory factor 8 by DNA methylation is a molecular determinant of apoptotic resistance and metastatic phenotype in metastatic tumor cells.
A novel interferon regulatory factor (IRF), IRF-10, has a unique role in immune defense and is induced by the v-Rel oncoprotein.
Yang D, Thangaraju M, Greeneltch K, Browning DD, Schoenlein PV, Tamura T, Ozato K, Ganapathy V, Abrams SI, Liu K
Cancer research 2007 Apr 1;67(7):3301-9
Cancer research 2007 Apr 1;67(7):3301-9
A novel interferon regulatory factor (IRF), IRF-10, has a unique role in immune defense and is induced by the v-Rel oncoprotein.
Nehyba J, Hrdlicková R, Burnside J, Bose HR Jr
Molecular and cellular biology 2002 Jun;22(11):3942-57
Molecular and cellular biology 2002 Jun;22(11):3942-57
No comments: Submit comment
No validations: Submit validation data