HPA002531

IRF8 antibody from Sigma-Aldrich
ICSBP, ICSBP1, IRF-8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002531
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002531, RRID:AB_1851904
Product name
Anti-IRF8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002531
Antibody type
Polyclonal
Antigen
Interferon regulatory factor 8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PDFEEVTDRSQLDISEPYKVYRIVPEEEQKCKLGV
ATAGCVNEVTEMECGRSEIDELIKEPSVDDYMGMI
KRSPSPPEACRSQLLPDWWAQQPSTGVPLVTGYTT
YDAHHSAFSQMVISFYY
Storage
-20C
Provider Type Product Number
- No reagents -