Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA002695 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA002695, RRID:AB_1852758
- Product name
- Anti-LCN2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVG
LAGNAILREDKDPQKMYATIYELKEDKSYNVTSVL
FRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTS
YLVRVVSTNYNQHAMVFFKKVSQNREYFKITL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Roles of neutrophil gelatinase-associated lipocalin (NGAL) in human cancer.
Expression of neutrophil gelatinase-associated lipocalin in colorectal neoplastic progression: a marker of malignant potential?
Lipocalin 2 Plays an Immunomodulatory Role and Has Detrimental Effects after Spinal Cord Injury
Candido S, Maestro R, Polesel J, Catania A, Maira F, Signorelli SS, McCubrey JA, Libra M
Oncotarget 2014 Mar 30;5(6):1576-94
Oncotarget 2014 Mar 30;5(6):1576-94
Expression of neutrophil gelatinase-associated lipocalin in colorectal neoplastic progression: a marker of malignant potential?
McLean MH, Thomson AJ, Murray GI, Fyfe N, Hold GL, El-Omar EM
British journal of cancer 2013 Jun 25;108(12):2537-41
British journal of cancer 2013 Jun 25;108(12):2537-41
Lipocalin 2 Plays an Immunomodulatory Role and Has Detrimental Effects after Spinal Cord Injury
Rathore K, Berard J, Redensek A, Chierzi S, Lopez-Vales R, Santos M, Akira S, David S
Journal of Neuroscience 2011 September;31(38):13412-13419
Journal of Neuroscience 2011 September;31(38):13412-13419
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in Capan-2 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-LCN2 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human bone marrow and cerebral cortex tissues using Anti-LCN2 antibody. Corresponding LCN2 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human bone marrow shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows low expression as expected.
- Sample type
- HUMAN