Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1106720 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Claudin 9 (CLDN9) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CLDN9 antibody: synthetic peptide directed towards the C terminal of human CLDN9
- Description
- Purified using Protein A affinity column
- Reactivity
- Human, Mouse, Rat, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
WAAAALLMLGGGLLCCTCPPPQVERPRGPRLGYSI
PSRSGASGLDKRDYV- Epitope
- C-Term
- Vial size
- 0.1 mg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references CLDN23 gene, frequently down-regulated in intestinal-type gastric cancer, is a novel member of CLAUDIN gene family.
Katoh M, Katoh M
International journal of molecular medicine 2003 Jun;11(6):683-9
International journal of molecular medicine 2003 Jun;11(6):683-9
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human HepG2; WB Suggested Anti-CLDN9 Antibody Titration: 2.0ug/ml. Positive Control: HepG2 cell lysate; CLDN9 antibody - C-terminal region (AP42229PU-N) in Human HepG2 cells using Western Blot