Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406501 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-MAP Kinase Interacting serine/threonine Kinase 2 (MKNK2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MKNK2 antibody: synthetic peptide directed towards the N terminal of human MKNK2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
SDFGLQCSARPDMPASQPIDIPDAKKRGKKKKRGR
ATDSF SGRFEDVYQL- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Interaction between Mnk2 and CBC(VHL) ubiquitin ligase E3 complex.
Wang P, Wang X, Wang F, Cai T, Luo Y
Science in China. Series C, Life sciences / Chinese Academy of Sciences 2006 Jun;49(3):265-73
Science in China. Series C, Life sciences / Chinese Academy of Sciences 2006 Jun;49(3):265-73
No comments: Submit comment
No validations: Submit validation data