ABIN406501

MKNK2 antibody from antibodies-online
GPRK7, MNK2
Western blot
Recommended by provider
Immunohistochemistry
Data presented on provider website

Antibody data

Product number
ABIN406501
Provider
antibodies-online
Product name
anti-MAP Kinase Interacting serine/threonine Kinase 2 (MKNK2) (N-Term) antibody
Provider product page
antibodies-online - ABIN406501
Antibody type
Polyclonal
Antigen
The immunogen for anti-MKNK2 antibody: synthetic peptide directed towards the N terminal of human MKNK2
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
SDFGLQCSARPDMPASQPIDIPDAKKRGKKKKRGR
ATDSF SGRFEDVYQL
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -