Antibody data

Product number
H00009139-M15
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009139-M15, RRID:AB_1204064
Product name
CBFA2T2 monoclonal antibody (M15), clone 2C10
Provider product page
Abnova Corporation - H00009139-M15
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CBFA2T2.
Antigen sequence
LLLNTSIASPADSSELLMEVHGNGKRPSPERREEN
SFDRDTIAPEPPAKRVCTISPAPRHSPALTVPLMN
PGGQFHPTPPPLQHYTLEDIATSHLYREPNKMLE
Isotype
IgG
Antibody clone number
2C10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -