Antibody data

Product number
H00000332-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000332-M01, RRID:AB_605980
Product name
BIRC5 monoclonal antibody (M01), clone 5B10
Provider product page
Abnova Corporation - H00000332-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant BIRC5.
Antigen sequence
MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTP
ERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPD
DDPIEEHKKHSSGCAFLSVKKQFEELTLGE
Isotype
IgG
Antibody clone number
5B10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -