Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000332-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000332-M01, RRID:AB_605980
- Product name
- BIRC5 monoclonal antibody (M01), clone 5B10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant BIRC5.
- Antigen sequence
MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTP
ERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPD
DDPIEEHKKHSSGCAFLSVKKQFEELTLGE- Isotype
- IgG
- Antibody clone number
- 5B10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Survivin expression induced by endothelin-1 promotes myofibroblast resistance to apoptosis.
The closely related RNA helicases, UAP56 and URH49, preferentially form distinct mRNA export machineries and coordinately regulate mitotic progression.
Horowitz JC, Ajayi IO, Kulasekaran P, Rogers DS, White JB, Townsend SK, White ES, Nho RS, Higgins PD, Huang SK, Sisson TH
The international journal of biochemistry & cell biology 2012 Jan;44(1):158-69
The international journal of biochemistry & cell biology 2012 Jan;44(1):158-69
The closely related RNA helicases, UAP56 and URH49, preferentially form distinct mRNA export machineries and coordinately regulate mitotic progression.
Yamazaki T, Fujiwara N, Yukinaga H, Ebisuya M, Shiki T, Kurihara T, Kioka N, Kambe T, Nagao M, Nishida E, Masuda S
Molecular biology of the cell 2010 Aug 15;21(16):2953-65
Molecular biology of the cell 2010 Aug 15;21(16):2953-65
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of BIRC5 expression in transfected 293T cell line by BIRC5 monoclonal antibody (M01), clone 5B10.Lane 1: BIRC5 transfected lysate(16.4 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged BIRC5 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to BIRC5 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of BIRC5 transfected lysate using anti-BIRC5 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with BIRC5 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
