HPA002830

BIRC5 antibody from Sigma-Aldrich
API4, EPR-1, survivin
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002830
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002830, RRID:AB_1857672
Product name
Anti-BIRC5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002830
Antibody type
Polyclonal
Antigen
Baculoviral IAP repeat-containing protein 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTP
ERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPD
DDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLD
RERAKNKIAKETNNKKKEFEETA
Storage
-20C
Provider Type Product Number
- No reagents -