HPA003056

CASP1 antibody from Atlas Antibodies
ICE, IL1BC
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003056
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003056, RRID:AB_1846037
Product name
Anti-CASP1
Provider product page
Atlas Antibodies - HPA003056
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRG
DSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAH
IEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHM
QEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERV
TLTRCFYLFPGH
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -