HPA003056

CASP1 antibody from Sigma-Aldrich
ICE, IL1BC
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003056
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003056, RRID:AB_1846037
Product name
Anti-CASP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003056
Antibody type
Polyclonal
Antigen
Caspase-1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRG
DSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAH
IEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHM
QEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERV
TLTRCFYLFPGH
Storage
-20C
Provider Type Product Number
- No reagents -