HPA002554

DDX24 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002554
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002554, RRID:AB_1078631
Product name
Anti-DDX24 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002554
Antibody type
Polyclonal
Antigen
ATP-dependent RNA helicase DDX24 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FPVQTKYMDVVKERIRLARQIEKSEYRNFQACLHN
SWIEQAAAALEIELEEDMYKGGKADQQEERRRQKQ
MKVLKKELRHLLSQPLFTESQKTKYPTQSGKPPLL
VSAPSKSESALSCLSKQKKKKTKKPKE
Storage
-20C
Provider Type Product Number
- No reagents -