HPA028048

SPTA1 antibody from Sigma-Aldrich
EL2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028048
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028048, RRID:AB_10603341
Product name
Anti-SPTA1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028048
Antibody type
Polyclonal
Antigen
spectrin, alpha, erythrocytic 1 (elliptocytosis 2) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HQGIVPAVYVRRLAHDEFPMLPQRRREEPGNITQR
QEQIENQYRSLLDRAEERRRRLLQRYNEFLLAYEA
GDMLEWIQEKKAENTGVEL
Storage
-20C
Provider Type Product Number
- No reagents -