HPA008421

PRKAR2B antibody from Sigma-Aldrich
PRKAR2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008421
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008421, RRID:AB_1855421
Product name
Anti-PRKAR2B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008421
Antibody type
Polyclonal
Antigen
cAMP-dependent protein kinase type II-beta regulatory subunit recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GFTVEVLRHQPADLLEFALQHFTRLQQENERKGTA
RFGHEGRTWGDLGAAAGGGTPSKGVNFAEEPMQSD
SEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEA
YNPDEEEDDAESRIIH
Storage
-20C
Provider Type Product Number
- No reagents -