HPA013448

UBAC2 antibody from Sigma-Aldrich
FLJ30548, PHGDHL1, RP11-178C10.1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013448
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013448, RRID:AB_1855301
Product name
Anti-PHGDHL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013448
Antibody type
Polyclonal
Antigen
Ubiquitin-associated domain-containing protein 2 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YDSKMFQVHQVLCIPSWMAKFFSWTLEPIFSSSEP
TSEARIGMGATLDIQRQQRMELLDRQLMFSQFAQG
RRQRQQQGGMINWNRLFPPLRQRQNVNYQGGRQSE
PAAPPLEVSEEQVARLMEMGFSRGDALEALRASNN
DLN
Storage
-20C
Provider Type Product Number
- No reagents -