HPA008266

PFKFB3 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008266
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008266, RRID:AB_1855239
Product name
Anti-PFKFB3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008266
Antibody type
Polyclonal
Antigen
6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EEAMKVRKQCALAALRDVKSYLAKEGGQIAVFDAT
NTTRERRHMILHFAKENDFKAFFIESVCDDPTVVA
SNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEAS
YQPLDPDKCDRDLSLIKVIDVGRRFLVNRVQD
Storage
-20C
Provider Type Product Number
- No reagents -