HPA018686

MRPS30 antibody from Sigma-Aldrich
PAP, PDCD9
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018686
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018686, RRID:AB_1854127
Product name
Anti-MRPS30 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018686
Antibody type
Polyclonal
Antigen
Mitochondrial 28S ribosomal protein S30 (S30mt) (MRP-S30) (Programmed cell death protein 9).
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EPEPEPALDLAALRAVACDCLLQEHFYLRRRRRVH
RYEESEVISLPFLDQLVSTLVGLLSPHNPALAAAA
LDYRCPVHFYWVRGEEIIPRGH
Storage
-20C
Provider Type Product Number
- No reagents -